SLFN5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLFN5 antibody is: synthetic peptide directed towards the N-terminal region of Human SLFN5. Synthetic peptide located within the following region: VDAGKVTLGTQQRQEMDPRLREKQNEIILRAVCALLNSGGGIIKAEIENK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	98 kDa
Gene Name	schlafen family member 5
Database Link	NP_659412 Entrez Gene 162394 Human UniProt ID Q08AF3
Background	SLFN5 may have a role in hematopoietic cell differentiation.
Synonyms	MGC19764; MGC150611; MGC150612
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.