RINL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IP, WB
Recommend Dilution	IP, WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RINL antibody is: synthetic peptide directed towards the N-terminal region of Human RINL. Synthetic peptide located within the following region: ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	Ras and Rab interactor like
Database Link	NP_940847 Entrez Gene 126432 Human UniProt ID Q6ZS11
Background	The function of this protein remains unknown.
Synonyms	FLJ44131; FLJ45909
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.