Qsox2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Qsox2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Qsox2. Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	quiescin Q6 sulfhydryl oxidase 2
Database Link	NP_705787 Entrez Gene 227638 Mouse UniProt ID Q3TMX7
Background	Qsox2 catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. It may contribute to disulfide bond formation in a variety of secreted proteins.
Synonyms	DKFZp762A2013; QSCN6L1; SOXN
Note	Immunogen Sequence Homology: Human: 100%; Rat: 86%; Bovine: 86%; Dog: 85%; Pig: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.