MYSM1 Rabbit Polyclonal Antibody
CAT#: TA334333
Rabbit Polyclonal Anti-MYSM1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the N-terminal region of Human MYSM1. Synthetic peptide located within the following region: KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 91 kDa |
Gene Name | Myb like, SWIRM and MPN domains 1 |
Database Link | |
Background | MYSM1 is a metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. It preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. MYSM1 acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation. |
Synonyms | 2A-DUB; 2ADUB |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Protease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |