MYSM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the N-terminal region of Human MYSM1. Synthetic peptide located within the following region: KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	Myb like, SWIRM and MPN domains 1
Database Link	NP_001078956 Entrez Gene 114803 Human UniProt ID Q5VVJ2
Background	MYSM1 is a metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. It preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. MYSM1 acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation.
Synonyms	2A-DUB; 2ADUB
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.