A1BG Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-A1BG antibody: synthetic peptide directed towards the C terminal of human A1BG. Synthetic peptide located within the following region: REGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	alpha-1-B glycoprotein
Database Link	NP_570602 Entrez Gene 1 Human UniProt ID P04217
Background	A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Synonyms	A1B; ABG; GAB; HYST2477
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Rat: 90%; Dog: 83%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.