A1BG Rabbit Polyclonal Antibody

CAT#: TA334283

Rabbit Polyclonal Anti-A1BG Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of alpha-1-B glycoprotein (A1BG)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human alpha-1-B glycoprotein (A1BG), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human alpha-1-B glycoprotein (A1BG), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-A1BG antibody: synthetic peptide directed towards the N terminal of human A1BG. Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 52 kDa
Gene Name alpha-1-B glycoprotein
Background A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 BX325198.2 1-7 8-1722 AB073611.1 1-1715 1723-1766 AK056201.1 462-505
Synonyms A1B; ABG; GAB; HYST2477
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...