FABP4 Rabbit Polyclonal Antibody

CAT#: TA334271

Rabbit Polyclonal Anti-FABP4 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of fatty acid binding protein 4, adipocyte (FABP4)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 15 kDa
Gene Name fatty acid binding protein 4
Background FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]
Synonyms A-FABP; AFABP; ALBP; aP2; HEL-S-104
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Goat: 86%; Horse: 86%; Mouse: 86%; Sheep: 86%; Rat: 85%; Bovine: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways PPAR signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...