PARP9 Rabbit Polyclonal Antibody
CAT#: TA334269
Rabbit Polyclonal Anti-PARP9 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PARP9 antibody: synthetic peptide directed towards the N terminal of human PARP9. Synthetic peptide located within the following region: LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 96 kDa |
Gene Name | poly(ADP-ribose) polymerase family member 9 |
Database Link | |
Background | PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown. |
Synonyms | ARTD9; BAL; BAL1; MGC:7868 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |