FOXQ1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	forkhead box Q1
Database Link	NP_150285 Entrez Gene 94234 Human UniProt ID Q9C009
Background	FOXQ1 contains 1 fork-head DNA-binding domain. FOXQ1 mediates the interaction of Akt/protein kinase B with TGFb2. Foxq1 regulates differentiation of hair in satin mice.
Synonyms	HFH1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.