Claudin 4 (CLDN4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CLDN4 antibody is: synthetic peptide directed towards the C-terminal region of Human CLDN4. Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	claudin 4
Database Link	NP_001296 Entrez Gene 1364 Human UniProt ID O14493
Background	This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
Synonyms	CPE-R; CPER; CPETR; CPETR1; hCPE-R; WBSCR8
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 92%; Sheep: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.