SLC10A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Slc10a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	solute carrier family 10 member 2
Database Link	NP_000443 Entrez Gene 20494 Mouse UniProt ID Q12908
Background	Slc10a2 plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. It plays a key role in cholesterol metabolism.
Synonyms	ASBT; IBAT; ISBT; NTCP2; PBAM
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.