ARHGAP11B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARHGAP11B Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP11B. Synthetic peptide located within the following region: MDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	Rho GTPase activating protein 11B
Database Link	NP_001034930 Entrez Gene 89839 Human UniProt ID Q3KRB8
Background	The function of this protein remains unknown.
Synonyms	B'-T; B -T; FAM7B1
Note	Immunogen sequence homology: Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 83%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.