EIF4E1B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF4E1B. Synthetic peptide located within the following region: EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	eukaryotic translation initiation factor 4E family member 1B
Database Link	NP_001092878 Entrez Gene 253314 Human UniProt ID A6NMX2
Background	EIF4E1B recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structure.
Synonyms	FLJ36951
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Pathways	Insulin signaling pathway, mTOR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.