ACYP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ACYP1 Antibody is: synthetic peptide directed towards the middle region of Human ACYP1. Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	acylphosphatase 1
Database Link	NP_001098 Entrez Gene 97 Human UniProt ID P07311
Background	Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis.
Synonyms	ACYPE
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 85%
Reference Data
Protein Pathways	Pyruvate metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.