ENT2 (SLC29A2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the C terminal of human SLC29A2. Synthetic peptide located within the following region: PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	solute carrier family 29 member 2
Database Link	NP_001523 Entrez Gene 3177 Human UniProt ID Q14542
Background	SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
Synonyms	DER12; ENT2; HNP36
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.