KRTHB3 (KRT83) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KRT83 Antibody is: synthetic peptide directed towards the middle region of Human KRT83. Synthetic peptide located within the following region: EEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	keratin 83
Database Link	NP_002273 Entrez Gene 3889 Human UniProt ID P78385
Background	The function of this protein remains unknown.
Synonyms	Hb-3; HB3; KRTHB3
Note	Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 91%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.