AE2 (SLC4A2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC4A2 Antibody: synthetic peptide directed towards the N terminal of human SLC4A2. Synthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	137 kDa
Gene Name	solute carrier family 4 member 2
Database Link	NP_003031 Entrez Gene 20535 MouseEntrez Gene 6522 Human UniProt ID P04920
Background	SLC4A2 is a plasma membrane anion exchange protein of wide distribution.
Synonyms	AE2; BND3L; EPB3L1; HKB3; NBND3
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%; Dog: 92%; Rat: 92%; Bovine: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.