SUPT5H Rabbit Polyclonal Antibody

CAT#: TA334033

Rabbit Polyclonal Anti-SUPT5H Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Purified recombinant protein of Homo sapiens suppressor of Ty 5 homolog (S. cerevisiae) (SUPT5H), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of suppressor of Ty 5 homolog (S. cerevisiae) (SUPT5H), transcript variant 4
    • 100 ug

CN¥ 4,840.00


Purified recombinant protein of Homo sapiens suppressor of Ty 5 homolog (S. cerevisiae) (SUPT5H), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SUPT5H Antibody: synthetic peptide directed towards the C terminal of human SUPT5H. Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 121 kDa
Gene Name SPT5 homolog, DSIF elongation factor subunit
Background SUPT5H and its binding partner regulate transcriptional elongation by RNA polymerase II. SPT4 and SPT5 are involved in both 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole (DRB)-mediated transcriptional inhibition and the activation of transcriptional elongation by the human immunodeficiency virus type 1 (HIV-1) Tat protein.
Synonyms SPT5; SPT5H; Tat-CT1
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 92%; Zebrafish: 92%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...