SUCLG2 Rabbit Polyclonal Antibody
CAT#: TA333987
Rabbit Polyclonal Anti-SUCLG2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SUCLG2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SUCLG2. Synthetic peptide located within the following region: AKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | succinate-CoA ligase GDP-forming beta subunit |
Database Link | |
Background | This gene encodes a GTP-specific beta subunit of succinyl-CoA synthetase. Succinyl-CoA synthetase catalyzes the reversible reaction involving the formation of succinyl-CoA and succinate. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 5 and 12. |
Synonyms | GBETA |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Citrate cycle (TCA cycle), Metabolic pathways, Propanoate metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |