EAAT3 (SLC1A1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC1A1 Antibody: synthetic peptide directed towards the N terminal of human SLC1A1. Synthetic peptide located within the following region: VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	solute carrier family 1 member 1
Database Link	NP_004161 Entrez Gene 6505 Human UniProt ID P43005
Background	SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5.
Synonyms	DCBXA; EAAC1; EAAT3; SCZD18
Note	Immunogen sequence homology: Human: 100%; Rabbit: 86%; Dog: 79%; Pig: 77%; Rat: 77%; Mouse: 77%; Bovine: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.