PAMCI (RASSF9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RASSF9 Antibody is: synthetic peptide directed towards the C-terminal region of Human RASSF9. Synthetic peptide located within the following region: FHLDRVENDGENYVQDAYLMPSFSEVEQNLDLQYEENQTLEDLSESDGIE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	Ras association domain family member 9
Database Link	NP_005438 Entrez Gene 9182 Human UniProt ID O75901
Background	The protein encoded by this gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways.
Synonyms	P-CIP1; PAMCI; PCIP1
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Pig: 83%; Guinea pig: 83%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.