PDI (PDIA2) Rabbit Polyclonal Antibody

CAT#: TA333911

Rabbit Polyclonal Anti-PDIA2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of protein disulfide isomerase family A, member 2 (PDIA2)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human protein disulfide isomerase family A, member 2 (PDIA2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human protein disulfide isomerase family A, member 2 (PDIA2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-PDIA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDIA2. Synthetic peptide located within the following region: EFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLED
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name protein disulfide isomerase family A member 2
Background Protein disulfide isomerases, such as PDIP, are endoplasmic reticulum (ER) resident proteins that catalyze protein folding and thiol-disulfide interchange reactions.
Synonyms PDA2; PDI; PDIP; PDIR
Note Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 93%; Dog: 92%; Horse: 86%; Guinea pig: 86%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...