SLC5A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC5A4 Antibody: synthetic peptide directed towards the N terminal of human SLC5A4. Synthetic peptide located within the following region: MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	solute carrier family 5 member 4
Database Link	NP_055042 Entrez Gene 6527 Human UniProt ID Q9NY91
Background	SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter.
Synonyms	DJ90G24.4; SAAT1; SGLT3
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.