Upstream Binding Protein 1 (UBP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	upstream binding protein 1 (LBP-1a)
Database Link	NP_055332 Entrez Gene 7342 Human UniProt ID Q9NZI7
Background	UBP1 is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of UBP1, exerting both positive and negative effects
Synonyms	LBP-1a; LBP-1B; LBP1A; LBP1B
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Rabbit: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.