ENDOD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ENDOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENDOD1. Synthetic peptide located within the following region: DLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	endonuclease domain containing 1
Database Link	NP_055851 Entrez Gene 23052 Human UniProt ID O94919
Background	ENDOD1 may act as a DNase and a Rnase.
Synonyms	KIAA0830; MGC88092
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Apoptosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.