PKNOX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PKNOX2 Antibody: synthetic peptide directed towards the N terminal of human PKNOX2. Synthetic peptide located within the following region: ATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	PBX/knotted 1 homeobox 2
Database Link	NP_071345 Entrez Gene 63876 Human UniProt ID Q96KN3
Background	PKNOX2 is a TALE homeodomain protein that shows distinct homology with PKNOX1. It may interact with PBX proteins and play a tissue-specific regulation of transcription.
Synonyms	PREP2
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.