Sec14l3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Sec14l3 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	SEC14-like lipid binding 3
Database Link	NP_072130 Entrez Gene 64543 Rat
Background	Sec14l3 is a probable hydrophobic ligand-binding protein; It may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.
Synonyms	MGC119366; MGC119367; MGC119368; TAP2
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.