DEM1 (EXO5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DEM1 Antibody is: synthetic peptide directed towards the C-terminal region of Human DEM1. Synthetic peptide located within the following region: RPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	exonuclease 5
Database Link	NP_073611 Entrez Gene 64789 Human UniProt ID Q9H790
Background	DEM1 is a probable single strand DNA specific 5' exonuclease mitochondrial DNA replication and recombination.
Synonyms	C1orf176; DEM1; Exo V; hExo5
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Bovine: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.