CCDC97 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC97 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC97. Synthetic peptide located within the following region: LDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	coiled-coil domain containing 97
Database Link	NP_443080 Entrez Gene 90324 Human UniProt ID Q96F63
Background	The function of this protein remains unknown.
Synonyms	FLJ40267; MGC20255
Note	Immunogen sequence homology: 0
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.