C20orf96 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C20orf96 Antibody is: synthetic peptide directed towards the N-terminal region of Human C20orf96. Synthetic peptide located within the following region: SIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	chromosome 20 open reading frame 96
Database Link	NP_542138 Entrez Gene 140680 Human UniProt ID Q9NUD7
Background	The function of this protein remains unknown.
Synonyms	dJ1103G7.2
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.