SLC35A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC35A4 Antibody: synthetic peptide directed towards the middle region of human SLC35A4. Synthetic peptide located within the following region: GLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	solute carrier family 35 member A4
Database Link	NP_542401 Entrez Gene 113829 Human UniProt ID Q96G79
Background	The function of this protein remains unknown.
Synonyms	MGC2541
Note	Immunogen sequence homology: Human: 100%; Yeast: 100%; Horse: 87%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.