SLC39A12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC39A12 Antibody: synthetic peptide directed towards the N terminal of human SLC39A12. Synthetic peptide located within the following region: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	solute carrier family 39 member 12
Database Link	NP_689938 Entrez Gene 221074 Human UniProt ID Q504Y0
Background	SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.
Synonyms	bA570F3.1; LZT-Hs8; ZIP-12
Note	Immunogen sequence homology: Human: 100%; Horse: 85%; Bovine: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.