SNX20 Rabbit Polyclonal Antibody
CAT#: TA333467
Rabbit Polyclonal Anti-SNX20 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SNX20 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNX20. Synthetic peptide located within the following region: GHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 14 kDa |
Gene Name | sorting nexin 20 |
Database Link | |
Background | SNX20 interacts with the cytoplasmic domain of PSGL1 and cycles PSGL1 into endosomes. |
Synonyms | SLIC1 |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 92%; Rabbit: 92%; Guinea pig: 86%; Dog: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |