SNX20 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SNX20 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNX20. Synthetic peptide located within the following region: GHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	sorting nexin 20
Database Link	NP_699168 Entrez Gene 124460 Human UniProt ID Q7Z614
Background	SNX20 interacts with the cytoplasmic domain of PSGL1 and cycles PSGL1 into endosomes.
Synonyms	SLIC1
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 92%; Rabbit: 92%; Guinea pig: 86%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.