MYLK3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	myosin light chain kinase 3
Database Link	NP_872299 Entrez Gene 91807 Human UniProt ID Q32MK0
Background	Phosphorylation of cardiac myosin heavy chains and light chains by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes.
Synonyms	caMLCK; MLCK; MLCK2
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 86%; Pig: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Calcium signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.