Phospholipase C beta 1 (PLCB1) Rabbit Polyclonal Antibody

CAT#: TA333384

Rabbit Polyclonal Anti-PLCB1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 134 kDa
Gene Name phospholipase C beta 1
Background The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction
Synonyms EIEE12; PI-PLC; PLC-154; PLC-I; PLC154; PLCB1A; PLCB1B
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Calcium signaling pathway, Chemokine signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Inositol phosphate metabolism, Long-term depression, Long-term potentiation, Melanogenesis, Metabolic pathways, Phosphatidylinositol signaling system, Vascular smooth muscle contraction, Wnt signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...