SPDYA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the N terminal of human SPDYA. Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	speedy/RINGO cell cycle regulator family member A
Database Link	NP_877433 Entrez Gene 245711 Human UniProt ID Q5MJ70
Background	SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
Synonyms	RINGO3; RINGOA; SPDY1; SPY1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 92%; Mouse: 85%; Rabbit: 85%
Reference Data
Protein Pathways	Oocyte meiosis, Progesterone-mediated oocyte maturation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.