RIPK5 (DSTYK) Rabbit Polyclonal Antibody

CAT#: TA333333

Rabbit Polyclonal Anti-DSTYK Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human dual serine/threonine and tyrosine protein kinase (DSTYK), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of dual serine/threonine and tyrosine protein kinase (DSTYK), transcript variant 1
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of dual serine/threonine and tyrosine protein kinase (DSTYK), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-DSTYK Antibody: synthetic peptide directed towards the middle region of human RIPK5. Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 100 kDa
Gene Name dual serine/threonine and tyrosine protein kinase
Background RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Synonyms CAKUT1; DustyPK; HDCMD38P; RIP5; RIPK5
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rat: 90%; Mouse: 86%; Bovine: 86%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome, Protein Kinase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...