LRRN4CL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LRRN4CL Antibody: synthetic peptide directed towards the middle region of human LOC221091. Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	LRRN4 C-terminal like
Database Link	NP_981967 Entrez Gene 221091 Human UniProt ID Q8ND94
Background	The function of this protein remains unknown.
Synonyms	MGC61707
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Dog: 79%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.