OR51M1 Rabbit Polyclonal Antibody
CAT#: TA332307
Rabbit Polyclonal Anti-OR51M1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-OR51M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51M1. Synthetic peptide located within the following region: LYGLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQTCTAHRC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | olfactory receptor family 51 subfamily M member 1 |
Database Link | |
Background | Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. |
Synonyms | HOR5 Beta7; HOR5'Beta7; OR11-40 |
Note | Immunogen sequence homology: Human: 100%; Mouse: 93%; Rabbit: 93%; Dog: 92% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Olfactory transduction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |