ABCF1 Rabbit Polyclonal Antibody
CAT#: TA332251
Rabbit Polyclonal Anti-Abcf1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IP, WB |
Recommend Dilution | IP, WB |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Abcf1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 95 kDa |
Database Link | |
Background | Abcf1 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Abcf1 is not involved in the ribosome biogenesis. |
Synonyms | ABC27; ABC50 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |