ACSM4 Rabbit Polyclonal Antibody
CAT#: TA332218
Rabbit Polyclonal Anti-ACSM4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ACSM4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACSM4. Synthetic peptide located within the following region: DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 66 kDa |
Gene Name | acyl-CoA synthetase medium-chain family member 4 |
Database Link | |
Background | ACSM4 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro). |
Synonyms | acyl-CoA synthetase medium-chain family member 4 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86% |
Reference Data | |
Protein Pathways | Butanoate metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |