LIN54 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LIN54 Antibody is: synthetic peptide directed towards the C-terminal region of Human LIN54. Synthetic peptide located within the following region: TFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	lin-54 DREAM MuvB core complex component
Database Link	NP_001108479 Entrez Gene 132660 Human UniProt ID Q6MZP7
Background	LIN54 is a component of the LIN, or DREAM, complex, an essential regulator of cell cycle genes.
Synonyms	CXCDC1; JC8.6; MIP120; TCX1
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.