ABCA2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ABCA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ABCA2. Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	108 kDa
Gene Name	ATP binding cassette subfamily A member 2
Database Link	NP_001597 Entrez Gene 20 Human UniProt ID Q9BZC7
Background	The function of this protein remains unknown.
Synonyms	ABC2
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ABC transporters, Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.