PCYT2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PCYT2 Antibody: synthetic peptide directed towards the C terminal of human PCYT2. Synthetic peptide located within the following region: KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	phosphate cytidylyltransferase 2, ethanolamine
Database Link	NP_002852 Entrez Gene 5833 Human UniProt ID Q99447
Background	The function remains unknown.
Synonyms	ET
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 92%; Bovine: 86%; Zebrafish: 77%
Reference Data
Protein Pathways	Glycerophospholipid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.