AP4M1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-AP4M1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4M1. Synthetic peptide located within the following region: QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	adaptor related protein complex 4 mu 1 subunit
Database Link	NP_004713 Entrez Gene 9179 Human UniProt ID O00189
Background	This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system.
Synonyms	CPSQ3; MU-4; MU-ARP2; SPG50
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Goat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Pathways	Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.