PNMA1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PNMA1 Antibody: synthetic peptide directed towards the middle region of human PNMA1. Synthetic peptide located within the following region: KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	paraneoplastic Ma antigen 1
Database Link	NP_006020 Entrez Gene 9240 Human UniProt ID Q8ND90
Background	PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.
Synonyms	MA1
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.