SLC25A17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC25A17 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC25A17. Synthetic peptide located within the following region: APYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	solute carrier family 25 member 17
Database Link	NP_006349 Entrez Gene 10478 Human UniProt ID O43808
Background	This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport.
Synonyms	PMP34
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Rat: 92%; Dog: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.