MAP4K5 Rabbit Polyclonal Antibody
CAT#: TA332033
Rabbit Polyclonal Anti-MAP4K5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MAP4K5 Antibody: synthetic peptide directed towards the middle region of human MAP4K5. Synthetic peptide located within the following region: QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 95 kDa |
Gene Name | mitogen-activated protein kinase kinase kinase kinase 5 |
Database Link | |
Background | MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.This gene encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. |
Synonyms | GCKR; KHS; KHS1; MAPKKKK5 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Yeast: 77% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |