SGT1 (ECD) Rabbit Polyclonal Antibody

CAT#: TA332006

Rabbit Polyclonal Anti-ECD Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 2
    • 100 ug

CNY 4,840.00


Recombinant protein of human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-ECD Antibody: synthetic peptide directed towards the N terminal of human ECD. Synthetic peptide located within the following region: PAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 73 kDa
Gene Name ecdysoneless cell cycle regulator
Background The exact function of ECD remains unknown.
Synonyms GCR2; HSGT1; SGT1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...