PPAR gamma (PPARG) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	peroxisome proliferator activated receptor gamma
Database Link	NP_056953 Entrez Gene 5468 Human UniProt ID P37231
Background	PPARG is a receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. PPARG is the key regulator of adipocyte differentiation and glucose homeostasis.This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.
Synonyms	CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARgamma
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 85%
Reference Data
Protein Families	Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways	Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.